Chemo Cheer DUE Tues July 29th

Happy Thursday – First of all thank you all to those who participated in the “Pole Dancing” cheer! So fun! Laina thank you for leading from Philly, and Kathryn Anderson you win the prize for the best pole dance!

Hilary and I went to chemo this past Monday, pushed back a bit due to Hilary’s time at the Deepak Chopra center in CA, which she and her sister-in-law Clia attended a 4 day workshop. I was particularly excited because since Wells was born I have not been able to sit with Hilary and I lined up a sitter for Wells and arranged for Henley to stay late at “school” so I could just hang with my sis. As we waited for Katharine, Dr. Fain’s PA, who we adore, we shared some tears over this crazy journey. Hilary has been so incredibly positive and strong and like we all do at times, she was having a moment of doubt and fear and feeling rattled and thrown off course. Katharine was really helpful in reminding us that Hilary is an “outliner” the rule book has not been written about her, she is writing her own story and she has a lot to be hopeful for. She has already beaten so many odds. She ended up not getting chemo on Monday, her neutrophils were too low which happens after a lot of chemo, and just as we were about to head out to perhaps a foot massage or some fun sister time, Henley’s school called to say he was sick and needed to be picked up. It wasn’t the day either of us had planned but in some weird way it was a good day and I’m so glad that I get to spend these moments with my sister. That I’m just able to be here and part of her daily life and she part of mine, it truly is a gift.

So next chemo is Aug 1 and Sara Jane (age 7) and her mom, Ashley Ellison are leading. The theme is “Jokes” and Sara Jane is making a book of Jokes up for Hilary. If you have a good joke you want to add please email to Ashley. But what Ashley really would like is a picture of your child or pet or someone dear to you laughing. Because jokes after all are to make us laugh! Ashley will make up a book of the jokes and “laughs” and present to Hilary at chemo on Aug. 1st

As always, thank you for being part of Hilary’s chemo cheer – xo becca

Chemo Cheer DUE Fri July 11

Thank you to Jenny Reed for leading the last “crayontastic” cheer and to all who participated. So fun to see all the creative things and have some kids involved – very cute!

Next week Laina Cooke Driscoll is leading the cheer from Philadelphia. Her theme is called  “Pole Dancing” She writes.. “My sister Beth came up with the idea from the fun photo that Hills sent around last Fri at chemo.(to those who didn’t see it the photo was of Hilary, dancing with a wig on, with her IV pole at chemo a few weeks ago) I ask everyone to take a pic of themselves “pole dancing” somewhere fun. Laina took one of herself at the beach dancing with a flag pole to give you some food for fodder.

Please email Becca at xxxxxx by Fri, July 11th. Hilary is going to be in California at a Deepak Chopra retreat on her normal chemo day so it was pushed back to Monday, July 14th.

As always thank you! xo becca (writing from Chestnut Hill Farm in  Aspers, PA at Charles’ parents house)

Chemo Cheer DUE Wed June 25th

Thank you to Ruth Klann and Co for leading this week’s cheer. Not sure if any of the pictures made it to Facebook but Jason Klann raised the bar for Chemo Cheer! Jason you truly have a calling! Thank you to all who participated in “My Favorite Things.”

Next week Jenny Nichols Reed is leading the cheer from Vermont. Her theme is called  “Crayon-tastic!” She writes.. “Please get artsy and fun and get out your crayons to make Hills some love on paper. Please get your kids to join in too. Perhaps you can draw or attempt to draw a place Hills loves or something fun you have done together or just make her something from your heart.

I will leave a paper box out front on the porch or drop in the mailbox. You can mail as well but needs to get to me by Thurs at the latest. Probably the easiest is if you create something scan and make a PDF or jpeg and I can print out.

As always thank you! xo becca

Chemo Cheer DUE Wed June 18th

Sorry for not getting this out sooner! Henley was home sick and it seems one day just throws me off! Hilary has been doing great and hopefully she will post soon about her “handstand” 🙂 Thank you Robyn and all those who participated last chemo cheer!

The next chemo cheer will be lead by Ruth Klann. The theme is “Favorite Things” and Ruth and friends are really looking forward to putting together a cheer basket for Hilary. The theme came from the Sound of Music song with the same name. The lyrics refer to things that you can think about that bring comfort in hard times “Raindrops on roses, whiskers on kittens….”.  She’d love for everyone to send some favorite things or email her about their favorite things to share with Hilary to brighten her day.

We are looking forward to hearing from you!!!

xo becca

June 2, 2014

Hi Everyone,

There’s been so much activity in all aspects of my world these days with a new nephew, the kids out of school for the summer and various treatment options floating around. I feel a little off balance and I’m not sure if it’s excitement or fear, probably a combination of both. I went to Houston last Tuesday to meet with a surgeon at Baylor, Dr. Curley, whom my MD Anderson doctor recommended. My friend Ellen Halper met me there and took copious notes and asked great questions, thank you Ellen for getting a sitter so you could be with me!What amazing friends I have.

The gist of the visit was that Dr. Curley does think I am a candidate for surgery and is ready to move ahead whenever I am. Wow. It would be a big surgery, total removal of the right lobe of the liver and ablation to the left to remove all liver tumors as well as removal of the cancerous lymph nodes in the abdomen. This is a lot to consider of course. This is however what I have been hoping for. I will seek the opinion of a few other surgeons who are liver specialists like Dr. Curley in order to get a clearer picture of this option. In the meantime I am in the process of applying to immunotherapy clinical trials led by Dr. Rosenberg in Maryland and it will be a few weeks before I know if there is anything worth considering on that front. My guess is that since I am not failing standard treatment (chemo) and I am not having side effects of standard treatment that warrant its discontinuation, I will not qualify at this time for any trials.

I will continue with chemo as I have been for the past almost 6 months (!) and gather information about options as I go. I feel so fortunate that I am in this position of considering options. I continue to feel well and sometimes really feel like I don’t have cancer at all.

My spirit is soaring and that is in no small part to all of you. I have not written nearly enough about the cheers that take place each time I get chemo. What have I done to deserve all the love that is wrapped in every single cheer effort? Thank you to every person that has volunteered to be a cheerleader as well as each of you that has contributed to the cheers. I know you all have busy lives that stretch you so it is all the more meaningful that you have taken time to reflect on a theme and share a part of you with me. I don’t rightly know how to express how it fills my soul. This past week my friend Wendy Williams chose the most awesome theme “Hilary Moments”, I loved this Wendy – thank you!!  I sat and read as friends recounted moments we’ve shared that were meaningful to them or things about me they valued. What an amazing gift for me. I smiled through tears at the sweetness of those memories and compliments. It made me want to write back to each of you and share right back! I get to sit with friends and talk each time I get infused, and you all know how much I love to talk! In addition to Wendy sitting with me on Friday, my friend Susan Schotz who was in town from Chicago and used to be our neighbor our first year in Austin came to sit too. Thank you Susan for taking time out of your crammed week here in Austin to be with me!  As if that wasn’t enough company my friend Martin who is valiantly waging his own war on pancreatic cancer was at TX Oncology at the same time as I was and he came to sit with me too. I call him the gentle giant (in my head that is) and he has been such a wonderful support for me since the early days of my diagnosis. I look forward to infusion days and the friends I get to share time with and the surprises I get each time from all you who make my life so rich. These cheers are all gifts that I go back and look at, read, listen to and cherish. Thank you for being creative, for carving out time to think and be still, and for giving a part of you to me. Everyone should get to have this experience, minus the cancer and the chemo because it is truly amazing. I guess though, without the cancer and the chemo it would be different wouldn’t it…

One last thank you to my dear friend Adam Carroll. He ran the Heaven can Wait race on Sunday in Bend, OR in my honor. Thank you Adam for your love and support, and to Molly Carroll for the photo!

Nite, nite!

xoxo Hilary

IMG_4845

 

 

 

Kids Playdates on Chemo Days

Hi Austin friends – Now that school is officially out for summer break, Hilary is realizing that on the days she has chemo she needs more help with the kids. She has been using sitters but if anyone also has their kids “lying around being bored :)” and a playdate with either Phin or Charlotte would fit easily into your schedule please check the Saltzman Care Calendar.

I am filling in play date needs as I get them from Hilary so at this moment the only I know for sure is this Friday, June 6th she needs help with Charlotte from 8am to 12 noon. Phin is taken care of. I know she will probably need help again on June 20th and June 27th and possibly June 16th for a trip to Houston. So please continue to check the care calendar throughout the summer. 

THANK YOU in advance!

xo becca

 

Chemo Cheer DUE Wed, June 4th

Happy Weekend!

Hilary had chemo (Day 1) yesterday and Wendy Nakfoor, who led the theme of “A Hilary Moment”, was there sharing your stories. Thank you Wendy and to all who participated!

Fun is the theme for next week. Whatever that means to you – sweaty run, yoga, beach, time with your kids, red wine – whatever.. Also, might be fun to remember a time when you had fun with Hilary. Share pictures, music, etc. and please email to Robyn Malloy by Wednesday, June 4th. 

As always, thank you for being part of Hilary’s treatments and enjoy the weekend!

xo becca

May 25, 2014

10402598_10203944757563609_8525373540208427448_n

Eileen Rothenhausler carried and delivered my sister and brother-in-law’s baby yesterday, naturally. This is her 4th delivery – her two daughters with husband Gabriel, Olivia and Eva, and my two nephews, Henley and Baby D (waiting to be named!) This is miraculous. Thank you Eileen for deciding to embark on this journey and for knowing you could help someone and in turn bring so much happiness to so many people.

gp Steven’s Dad Gerry, girlfriend Connie and My Mom Joanne – proud grandparents

Becca and Steven have just completed their dream to be the parents of two children. This has been almost 8 years in the making. They have lost babies, one at 20 weeks and have had to make countless decisions and new plans. They have loved and supported each other on this journey to parenthood and have taught me that if you want something badly enough, you keep your heart attached to the belief that it will happen and know you will reach your destination. I have watched their unwavering belief that they would be parents and as I write this I am listening to their oldest child protest to his cousins about which show to watch. Music to my ears. Cousinhood is rich, I know this because I have amazing cousins whom I love and have grown up with and continue to be a very important part of my life.

grandparents This morning watching cartoons

dance Dance Party at the Dobberfuhls last weekend

One of the most remarkable things I’ve learned since the arrival of Henley 2.5 years ago is that a genetic link matters not at all when it comes to love. Henley and Baby D are egg donor babies with Steven being our only known biological link. Details details. These boys are ours and Becca has shown me that an open heart, despite devastating loss is what has allowed joy instead of sorrow to prevail. She never got stuck in the why me and the what ifs. That approach allowed her to be the Mama of two boys today. I am very proud of her and Steven for this.

While we are on this topic, I wanted to share that I got my first breast milk contribution a few weeks ago! About 25 ounces of days 1-3 breast milk came to me via midwife Julia Bower. One of her patients sadly lost her baby at 21 weeks due to an incompetent cervix. After she delivered she decided she wanted to donate her milk and she asked Julia how to go about this. Julia gave her all the information then let her know about my request and this angel donated the first 3 days to me. I am so thankful to her, to be so giving in the midst of her grief. I believe the Universe worked it’s magic and this all came to be because Becca and Steven lost their baby at 20 weeks due to an incompetent cervix almost 6 years ago. Thank you Julia for making this happen and to your patient to whom I send love and healing and hope that she can be a Mama again if she chooses.

I drank milk with Becca cheering me on for the first glass. I made a smoothie with almond milk, ice and protein powder. I was a little freaked out but then thought about the fact that we drink milk from cows all the time and they probably eat poop so really, how weird is this? It was pretty tasty but I have to admit I wasn’t brave enough to try it plain. I am still looking for donations of this kind so email me if you have a lead. It can be shipped to me frozen on dry ice, I will reimburse you for this.

milk milk 2

Life is rich.

xoxo Hilary

May 24, 2014

What a way to celebrate 11 years of marriage, a new member of our family made his debut today. My sister Becca and husband Steven and their son Henley welcomed a new baby boy today at 5:08pm. 8lbs 14 oz and 20.5 inches. He came into the world via gestational carrier, Eileen who carried Henley too. She naturally and quite quickly gave birth to baby D. Thank you Eileen and Gabriel for making Becca and Steven parents of two healthy boys and giving our family such joy. We are very blessed and so happy for Becca and Steven. Baby D remains nameless!

Our anniversary plans of dinner and live music took a back seat to meeting our new nephew and having nephew Henley spend the night with us while his parents stay at the hospital with their newborn.

I am so very grateful for my family, that we get to be so close for events like this and that I am healthy enough to enjoy it. I feel much better than I did yesterday and with all the excitement today I barely thought about recovery from the biopsy. No time! I am also so blessed to be celebrating 11 years of marriage to the man that has made me fall more deeply in love with him with each passing day. The last 6 months have been nothing short of surreal and full of uncertainty yet nothing is more solid then the ground I stand on with Charles. Here are lots of photos – a few of baby D and many of our wedding on Crissy Field in San Francisco on a foggy, windy day.

Nite, nite

xoxo Hilary

kids and babybec steve baby

Hilaryboysmarriedkissgrinfamilywindydanceunnamed